HPA003166

GTPBP1 antibody from Sigma-Aldrich
GP-1, HSPC018
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003166
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003166, RRID:AB_10601476
Product name
Anti-GTPBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003166
Antibody type
Polyclonal
Antigen
GTP binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKID
MCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDD
VIVTASNFSSERMCPIFQISNVTGENLDLLKMFLN
LLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTT
L
Storage
-20C
Provider Type Product Number
- No reagents -