Antibody data

Product number
H00084277-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084277-B01P, RRID:AB_10719100
Product name
WBSCR18 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00084277-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human WBSCR18 protein.
Antigen sequence
MAAMRWRWWQRLLPWRLLQARGFPQNSAPSLGLRA
RTYSQGDCSYSRTALYDLLGVPSTATQAQIKAAYY
RQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSAT
LRRKYDRGLLSDEDLRGPGVRPSRTPAPDPGSPRT
PPPTSRTHDGSRASPGANRTMFNFDAFYQAHYGEQ
LERERRLRARREALRKRQEYRSMKGLRWEDTRDTA
AIFLIFSIFIIIGFYI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.