HPA017318

DNAJC30 antibody from MilliporeSigma / Merck KGaA
WBSCR18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017318
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-DNAJC30 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017318
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily C member 30 (Williams-Beuren syndrome chromosomal region 18 protein)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGS
ATLRRKYDRGLLSDEDLRGPGVRPSRTPAPDPGSP
RTPPPTSRTHDGSRASPGANRTMFNFDAFYQAHYG
EQLERER
Storage
-20C