HPA017318

DNAJC30 antibody from Sigma-Aldrich
WBSCR18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017318
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017318, RRID:AB_1858788
Product name
Anti-DNAJC30 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017318
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily C member 30 (Williams-Beuren syndrome chromosomal region 18 protein)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGS
ATLRRKYDRGLLSDEDLRGPGVRPSRTPAPDPGSP
RTPPPTSRTHDGSRASPGANRTMFNFDAFYQAHYG
EQLERER
Storage
-20C
Provider Type Product Number
- No reagents -