HPA017292

B3GNT5 antibody from Sigma-Aldrich
B3GN-T5, beta3Gn-T5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017292
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017292, RRID:AB_1845237
Product name
Anti-B3GNT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017292
Antibody type
Polyclonal
Antigen
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVI
SGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGI
VPQDHVFFSGEGKTPYHPCIYEKMMTSHGHLEDLQ
DLWKNATDPKV
Storage
-20C
Provider Type Product Number
- No reagents -