HPA017292

B3GNT5 antibody from Atlas Antibodies
B3GN-T5, beta3Gn-T5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017292
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017292, RRID:AB_1845237
Product name
Anti-B3GNT5
Provider product page
Atlas Antibodies - HPA017292
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVI
SGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGI
VPQDHVFFSGEGKTPYHPCIYEKMMTSHGHLEDLQ
DLWKNATDPKV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -