HPA027435

ALPK1 antibody from Sigma-Aldrich
FLJ22670, KIAA1527, Lak
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027435
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027435, RRID:AB_10599614
Product name
Anti-ALPK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027435
Antibody type
Polyclonal
Antigen
alpha-kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDE
PVTGKQELHSFVKAAFGLTTVHRRLHGETGTVHAA
SQLCKEAMGKLYNFSTSSRSQDREALSQEV
Storage
-20C
Provider Type Product Number
- No reagents -