HPA054104

4.1N, KIAA0338

Antibody data

Submit

Validation data

Product number: HPA054104
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA054104, RRID:AB_2682380
Product name: Anti-EPB41L1
Provider product page: Atlas Antibodies - HPA054104
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSD TEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACST PDMPQFEPVKTETMTVSSLAIRKKIEPE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland using Anti-EPB41L1 antibody HPA054104.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-EPB41L1 antibody HPA054104.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-EPB41L1 antibody HPA054104.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-EPB41L1 antibody. Corresponding EPB41L1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, cerebral cortex, colon and kidney using Anti-EPB41L1 antibody HPA054104 (A) shows similar protein distribution across tissues to independent antibody HPA056817 (B).
Antibody #2 product nr: HPA056817
Antibody provider: Atlas Antibodies