Antibody data
- Product number
- HPA054104
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA054104, RRID:AB_2682380
- Product name
- Anti-EPB41L1
- Provider product page
- Atlas Antibodies - HPA054104
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSD
TEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACST
PDMPQFEPVKTETMTVSSLAIRKKIEPE
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line RT-4.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Western blot analysis using Anti-EPB41L1 antibody HPA054104 (A) shows similar pattern to independent antibody HPA056817 (B).
- Sample type
- HUMAN
- Antibody #2 product nr
- HPA056817
- Antibody provider
- Atlas Antibodies
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A549 shows localization to plasma membrane.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human adrenal gland using Anti-EPB41L1 antibody HPA054104.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney using Anti-EPB41L1 antibody HPA054104.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon using Anti-EPB41L1 antibody HPA054104.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-EPB41L1 antibody. Corresponding EPB41L1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human adrenal gland, cerebral cortex, colon and kidney using Anti-EPB41L1 antibody HPA054104 (A) shows similar protein distribution across tissues to independent antibody HPA056817 (B).
- Antibody #2 product nr
- HPA056817
- Antibody provider
- Atlas Antibodies
- Show more