HPA014402

FUT2 antibody from Sigma-Aldrich
SE, Se2, SEC2, sej
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014402
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014402, RRID:AB_1849194
Product name
Anti-FUT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014402
Antibody type
Polyclonal
Antigen
Galactoside 2-alpha-L-fucosyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMW
TINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQM
HSTL
Storage
-20C
Provider Type Product Number
- No reagents -