HPA017293

SCN4B antibody from Sigma-Aldrich
LQT10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017293
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017293, RRID:AB_2184174
Product name
Anti-SCN4B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017293
Antibody type
Polyclonal
Antigen
Sodium channel subunit beta-4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLPCTFSSCFGFEDLHFRWTYNSSDAFKILIEGTV
KNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLR
DLEFSDTGKYTCHVKNPKENNLQHHATIFLQVV
Storage
-20C
Provider Type Product Number
- No reagents -