H00006334-M04
antibody from Abnova Corporation
Targeting: SCN8A
CerIII, CIAT, MED, NaCh6, Nav1.6, PN4
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006334-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006334-M04, RRID:AB_607002
- Product name
- SCN8A monoclonal antibody (M04), clone 4G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SCN8A.
- Antigen sequence
RVLGDSGELDILRQQMEERFVASNPSKVSYEPITT
TLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSN
KLENGGTHREKKESTPSTASLPSYDSVT- Isotype
- IgG
- Antibody clone number
- 4G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Nav1.1 localizes to axons of parvalbumin-positive inhibitory interneurons: a circuit basis for epileptic seizures in mice carrying an Scn1a gene mutation.
Ogiwara I, Miyamoto H, Morita N, Atapour N, Mazaki E, Inoue I, Takeuchi T, Itohara S, Yanagawa Y, Obata K, Furuichi T, Hensch TK, Yamakawa K
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 May 30;27(22):5903-14
The Journal of neuroscience : the official journal of the Society for Neuroscience 2007 May 30;27(22):5903-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SCN8A on NIH/3T3 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol