HPA012316

GRAMD1C antibody from Sigma-Aldrich
DKFZp434C0328
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012316
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012316, RRID:AB_1849949
Product name
Anti-GRAMD1C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012316
Antibody type
Polyclonal
Antigen
GRAM domain-containing protein 1C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLE
SDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAE
TVPKLSSQHSSGDVGLGAKG
Storage
-20C
Provider Type Product Number
- No reagents -