HPA012316

GRAMD1C antibody from Atlas Antibodies
DKFZp434C0328
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012316
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012316, RRID:AB_1234484
Product name
Anti-GRAMD1C
Provider product page
Atlas Antibodies - HPA012316
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLE
SDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAE
TVPKLSSQHSSGDVGLGAKG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -