HPA012316

GRAMD1C antibody from Atlas Antibodies
DKFZp434C0328
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012316
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012316, RRID:AB_1849949
Product name
Anti-GRAMD1C
Provider product page
Atlas Antibodies - HPA012316
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLE
SDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAE
TVPKLSSQHSSGDVGLGAKG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -