HPA027395

OXR1 antibody from Sigma-Aldrich
TLDC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027395
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027395, RRID:AB_10601554
Product name
Anti-OXR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027395
Antibody type
Polyclonal
Antigen
oxidation resistance 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEYGIMCPMEEVMSAAMYKEILDSKIKESLPIDID
QLSGRDFCHSKKMTGSNTEEIDSRIRDAGNDSAST
APRSTEESLSEDVFTESELSPIR
Storage
-20C
Provider Type Product Number
- No reagents -