Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311265 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SLIT and NTRK-Like Family, Member 1 (SLITRK1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLITRK1 antibody: synthetic peptide directed towards the N terminal of human SLITRK1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDL
NETTE QDLCPLKNRV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Lack of association between SLITRK1var321 and Tourette syndrome in a large family-based sample.
Scharf JM, Moorjani P, Fagerness J, Platko JV, Illmann C, Galloway B, Jenike E, Stewart SE, Pauls DL, Tourette Syndrome International Consortium for Genetics
Neurology 2008 Apr 15;70(16 Pt 2):1495-6
Neurology 2008 Apr 15;70(16 Pt 2):1495-6
No comments: Submit comment
No validations: Submit validation data