HPA012414

SLITRK1 antibody from Sigma-Aldrich
KIAA1910, LRRC12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012414
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012414, RRID:AB_1857229
Product name
Anti-SLITRK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012414
Antibody type
Polyclonal
Antigen
SLIT and NTRK-like protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDL
LSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNET
TEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPF
KTNGQEDHATPGSAPNGGTKIPGNWQIKIRPTAAI
ATGSSRNKP
Storage
-20C
Provider Type Product Number
- No reagents -