H00084245-B01

MRI1 antibody from Abnova Corporation
MGC3207, MRDI, mtnA, Ypr118w

Antibody data

Product number
H00084245-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084245-B01, RRID:AB_1138625
Product name
MGC3207 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00084245-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC3207 protein.
Antigen sequence
MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQ
AWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGP
GLAALVAFVRDKLSFLVTARPTAVNMARAARDLAD
VAAREAEREGATEEAVRERVICCTEDMLEKDLRDN
RSIGDLGARHLLERVAPSGGKVTVLTHCNTGALAT
AGYGTALGVIRSLHSLGRLEHAFCTETRPYNQGAR
LTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVV
GADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAA
PSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAA
PGIGVWNPAFDVTPHDLITGGIITELGVFAPEELR
TALTTTISSRDGTLDGPQM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -