HPA002540

LRRC75B antibody from Sigma-Aldrich
C22orf36, FAM211B, MGC131773
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002540
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002540, RRID:AB_1079263
Product name
Anti-C22orf36 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002540
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein C22orf36 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVQHITRYLSSHGAVLAVLDLSFTGLSDELLHLLL
PSLWALPRLTQLLLNGNRLTRATARKLTDAIKDTT
KFPALAWVDLGNNVDVASLPQPLLVGLRRRLSQRT
SLPTIYEGLDLEPEGSAAGATTPASTWDS
Storage
-20C
Provider Type Product Number
- No reagents -