Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1545225 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chromosome 20 Open Reading Frame 4 (C20orf4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for Anti-AAR2 antibody is: synthetic peptide directed towards the N-terminal region of Human AAR2
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFF
LSLHQ RGLTVLRWST- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Host: Rabbit Target Name: AAR2 Sample Tissue: 721_B Whole Cell lysates Antibody Dilution: 1.0 μg/mL AAR2 is supported by BioGPS gene expression data to be expressed in 721_B