HPA007450

SPOCK1 antibody from Sigma-Aldrich
SPOCK, testican-1, TIC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007450
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007450, RRID:AB_10603116
Product name
Anti-SPOCK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007450
Antibody type
Polyclonal
Antigen
sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSK
GKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDK
YGNELAGSRKQGAVSCEEEQETSGDFGSGG
Storage
-20C
Provider Type Product Number
- No reagents -