PAB20804

IGDCC3 antibody from Abnova Corporation
HsT18880, PUNC

Antibody data

Product number
PAB20804
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20804, RRID:AB_10968436
Product name
IGDCC3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20804
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant IGDCC3.
Antigen sequence
SAELAFAVEPSDDVAVPGQPIVLDCRVEGTPPVRI
TWRKNGVELPESTHSTLLANGSLMIRHFRLEPGGS
PSDEGDYECVAQNRFGLVVSRKARIQAATMSDFHV
HPQATVGEEGGVARFQCQIHGLPKPLITWEKN
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -