HPA015246

IGDCC3 antibody from Sigma-Aldrich
HsT18880, PUNC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015246
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015246, RRID:AB_2122103
Product name
Anti-IGDCC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015246
Antibody type
Polyclonal
Antigen
Putative neuronal cell adhesion molecule precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAELAFAVEPSDDVAVPGQPIVLDCRVEGTPPVRI
TWRKNGVELPESTHSTLLANGSLMIRHFRLEPGGS
PSDEGDYECVAQNRFGLVVSRKARIQAATMSDFHV
HPQATVGEEGGVARFQCQIHGLPKPLITWEKN
Storage
-20C
Provider Type Product Number
- No reagents -