HPA013313

CHST2 antibody from Sigma-Aldrich
C6ST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013313
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013313, RRID:AB_1846717
Product name
Anti-CHST2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013313
Antibody type
Polyclonal
Antigen
Carbohydrate sulfotransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVR
YEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMT
SGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQ
VEEFCYQPMAVLGYERVNSPEEVKDLSKT
Storage
-20C
Provider Type Product Number
- No reagents -