HPA013313

CHST2 antibody from MilliporeSigma / Merck KGaA
C6ST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013313
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-CHST2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013313
Antibody type
Polyclonal
Antigen
Carbohydrate sulfotransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVR
YEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMT
SGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQ
VEEFCYQPMAVLGYERVNSPEEVKDLSKT
Storage
-20C