Antibody data

Product number
H00060436-M21
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00060436-M21, RRID:AB_1137061
Product name
TGIF2 monoclonal antibody (M20), clone 4B10
Provider product page
Abnova Corporation - H00060436-M21
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TGIF2.
Antigen sequence
LAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPR
GELESPKPLVTPGSTLTLLTRAEAGSP
Isotype
IgG
Antibody clone number
4B10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -