HPA057387

RAB5IF antibody from Atlas Antibodies
C20orf24, PNAS-11, RIP5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA057387
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA057387, RRID:AB_2683425
Product name
Anti-C20orf24
Provider product page
Atlas Antibodies - HPA057387
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -