Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311253 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Galactose-3-O-Sulfotransferase 3 (GAL3ST3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GAL3ST3 antibody: synthetic peptide directed towards the C terminal of human GAL3ST3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLL
RKQKR RGGARARPEP- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Potential tumor markers for human gastric cancer: an elevation of glycan:sulfotransferases and a concomitant loss of alpha1,2-fucosyltransferase activities.
Identification of physiologically relevant substrates for cloned Gal: 3-O-sulfotransferases (Gal3STs): distinct high affinity of Gal3ST-2 and LS180 sulfotransferase for the globo H backbone, Gal3ST-3 for N-glycan multiterminal Galbeta1, 4GlcNAcbeta units and 6-sulfoGalbeta1, 4GlcNAcbeta, and Gal3ST-4 for the mucin core-2 trisaccharide.
Chandrasekaran EV, Xue J, Piskorz C, Locke RD, Tóth K, Slocum HK, Matta KL
Journal of cancer research and clinical oncology 2007 Sep;133(9):599-611
Journal of cancer research and clinical oncology 2007 Sep;133(9):599-611
Identification of physiologically relevant substrates for cloned Gal: 3-O-sulfotransferases (Gal3STs): distinct high affinity of Gal3ST-2 and LS180 sulfotransferase for the globo H backbone, Gal3ST-3 for N-glycan multiterminal Galbeta1, 4GlcNAcbeta units and 6-sulfoGalbeta1, 4GlcNAcbeta, and Gal3ST-4 for the mucin core-2 trisaccharide.
Chandrasekaran EV, Lakhaman SS, Chawda R, Piskorz CF, Neelamegham S, Matta KL
The Journal of biological chemistry 2004 Mar 12;279(11):10032-41
The Journal of biological chemistry 2004 Mar 12;279(11):10032-41
No comments: Submit comment
No validations: Submit validation data