HPA013570

GAL3ST3 antibody from Sigma-Aldrich
GAL3ST2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013570
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013570, RRID:AB_1849424
Product name
Anti-GAL3ST3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013570
Antibody type
Polyclonal
Antigen
Galactose-3-O-sulfotransferase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSTVYVTILREPAAMFESLFSYYNQYCPAFRRVPN
ASLEAFLRAPEAYYRAGEHFAMFAHNTLAYDLGGD
NERSPRDDAAYLAGLIRQVEEVFSLVMIAEYFDES
LV
Storage
-20C
Provider Type Product Number
- No reagents -