Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502934 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tetratricopeptide Repeat Domain 35 (TTC35) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TTC35 antibody: synthetic peptide directed towards the middle region of human TTC35
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAI
RELNE YLEQFVGDQE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Nuclear envelope proteomics: novel integral membrane proteins of the inner nuclear membrane.
Dreger M, Bengtsson L, Schöneberg T, Otto H, Hucho F
Proceedings of the National Academy of Sciences of the United States of America 2001 Oct 9;98(21):11943-8
Proceedings of the National Academy of Sciences of the United States of America 2001 Oct 9;98(21):11943-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting