HPA059577

TTC7B antibody from Atlas Antibodies
TTC7L1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA059577
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA059577, RRID:AB_2684069
Product name
Anti-TTC7B
Provider product page
Atlas Antibodies - HPA059577
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HYHDALNIIDMALSEYPENFILLFSKVKLQSLCRG
PDEALLTCKHMLQIWKSCYNLTNPSDSGRGSSLLD
RTIADRRQLNTITLPDFSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -