HPA016700

TREML1 antibody from Sigma-Aldrich
dJ238O23.3, TLT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016700
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016700, RRID:AB_1858262
Product name
Anti-TREML1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016700
Antibody type
Polyclonal
Antigen
Trem-like transcript 1 protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSG
PAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSG
KPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGN
KGGGTSCGPAQNPPNNQTPSS
Storage
-20C
Provider Type Product Number
- No reagents -