HPA014899

ASGR2 antibody from Sigma-Aldrich
CLEC4H2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014899
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014899, RRID:AB_1845085
Product name
Anti-ASGR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014899
Antibody type
Polyclonal
Antigen
Asialoglycoprotein receptor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGG
SVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFP
VDLRFVACQMELLHSNGSQRTCC
Storage
-20C
Provider Type Product Number
- No reagents -