Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182980 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein-Like 1 (ZFPL1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFPL1 antibody: synthetic peptide directed towards the middle region of human ZFPL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
NGPIFPPTNLAGPVASALREKLATVNWARAGLGLP
LIDEV VSPEPEPLNT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A putative human zinc-finger gene (ZFPL1) on 11q13, highly conserved in the mouse and expressed in exocrine pancreas. The European Consortium on MEN 1.
Höppener JW, De Wit MJ, Simarro-Doorten AY, Roijers JF, van Herrewaarden HM, Lips CJ, Parente F, Quincey D, Gaudray P, Khodaei S, Weber G, Teh B, Farnebo F, Larsson C, Zhang CX, Calender A, Pannett AA, Forbes SA, Bassett JH, Thakker RV, Lemmens I, Van de Ven WJ, Kas K
Genomics 1998 Jun 1;50(2):251-9
Genomics 1998 Jun 1;50(2):251-9
No comments: Submit comment
No validations: Submit validation data