Antibody data

Product number
ABIN1109556
Provider
antibodies-online
Product name
anti-Zinc Finger Protein-Like 1 (ZFPL1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN1109556
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZFPL1 antibody: synthetic peptide directed towards the middle region of human ZFPL1
Description
Purified using peptide immunoaffinity column
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
NGPIFPPTNLAGPVASALREKLATVNWARAGLGLP
LIDEVVSPEPEPLNT
Epitope
Middle Region
Vial size
50 μg
Storage
Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -