Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109556 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein-Like 1 (ZFPL1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZFPL1 antibody: synthetic peptide directed towards the middle region of human ZFPL1
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
NGPIFPPTNLAGPVASALREKLATVNWARAGLGLP
LIDEVVSPEPEPLNT- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Muscle; WB Suggested Anti-ZFPL1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle; ZFPL1 antibody - middle region (AP42277PU-N) in Human Muscle cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human kidney; ZFPL1 antibody - middle region (AP42277PU-N) in Human kidney cells using Immunohistochemistry