HPA017347

ZFPL1 antibody from Sigma-Aldrich
D11S750, MCG4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017347
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017347, RRID:AB_1859056
Product name
Anti-ZFPL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017347
Antibody type
Polyclonal
Antigen
Zinc finger protein-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQS
YLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLF
HWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTN
LAG
Storage
-20C
Provider Type Product Number
- No reagents -