HPA014909

ZFPL1 antibody from Atlas Antibodies
D11S750, MCG4
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA014909
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014909, RRID:AB_1236197
Product name
Anti-ZFPL1
Provider product page
Atlas Antibodies - HPA014909
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDS
ASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPL
THAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALG
WLARLLRSRAGSRKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -