HPA017347

antibody from Atlas Antibodies

Targeting: ZFPL1 D11S750, MCG4

Antibody data

Submit

Validation data

Product number: HPA017347 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA017347, RRID:AB_1859056
Product name: Anti-ZFPL1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQS YLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLF HWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTN LAG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ZFPL1 protein structure - HPA017347 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, pancreas and testis using Anti-ZFPL1 antibody HPA017347 (A) shows similar protein distribution across tissues to independent antibody HPA014909 (B).
Antibody #2 product nr: HPA014909
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum shows cytoplasmic positivity with a granular pattern in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-ZFPL1 antibody HPA017347.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-ZFPL1 antibody HPA017347.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ZFPL1 antibody HPA017347.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ZFPL1 antibody HPA017347.
Sample type: HUMAN