HPA014907

PDZK1IP1 antibody from Sigma-Aldrich
DD96, MAP17, SPAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014907
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014907, RRID:AB_1855166
Product name
Anti-PDZK1IP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014907
Antibody type
Polyclonal
Antigen
PDZK1-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASF
RSSEHENAYENVPEEEGKVRST
Storage
-20C
Provider Type Product Number
- No reagents -