HPA014907

PDZK1IP1 antibody from Atlas Antibodies
DD96, MAP17, SPAP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014907
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014907, RRID:AB_1235145
Product name
Anti-PDZK1IP1
Provider product page
Atlas Antibodies - HPA014907
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASF
RSSEHENAYENVPEEEGKVRST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -