Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00123228-D01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00123228-D01, RRID:AB_10719576
- Product name
- SENP8 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human SENP8 protein.
- Antigen sequence
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFA
FEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAE
IAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSL
LVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFL
GRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALC
QNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLA
KK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Central role for endothelial human deneddylase-1/SENP8 in fine-tuning the vascular inflammatory response.
Ehrentraut SF, Kominsky DJ, Glover LE, Campbell EL, Kelly CJ, Bowers BE, Bayless AJ, Colgan SP
Journal of immunology (Baltimore, Md. : 1950) 2013 Jan 1;190(1):392-400
Journal of immunology (Baltimore, Md. : 1950) 2013 Jan 1;190(1):392-400
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SENP8 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP8 expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SENP8 expression in transfected 293T cell line (H00123228-T01) by SENP8 MaxPab polyclonal antibody.Lane 1: SENP8 transfected lysate(24.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of SENP8 transfected lysate using anti-SENP8 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SENP8 monoclonal antibody (M06), clone 2E1 (H00123228-M06).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol