HPA014302

DRAXIN antibody from Sigma-Aldrich
C1orf187, Draxin, FLJ34999, Neucrin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014302
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014302, RRID:AB_1853084
Product name
Anti-C1orf187 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014302
Antibody type
Polyclonal
Antigen
Draxin Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRS
DGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKH
RGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLRE
HLCTPHNRGLNNKCFDDCMCVEG
Storage
-20C
Provider Type Product Number
- No reagents -