HPA014302

DRAXIN antibody from Atlas Antibodies
C1orf187, Draxin, FLJ34999, Neucrin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014302
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014302, RRID:AB_1853084
Product name
Anti-DRAXIN
Provider product page
Atlas Antibodies - HPA014302
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRS
DGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKH
RGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLRE
HLCTPHNRGLNNKCFDDCMCVEG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -