Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003162-A02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003162-A02, RRID:AB_606395
- Product name
- HMOX1 polyclonal antibody (A02)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HMOX1.
- Antigen sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMR
NFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKE
SPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVI
PYTPA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Apoptosis induction of 2'-hydroxycinnamaldehyde as a proteasome inhibitor is associated with ER stress and mitochondrial perturbation in cancer cells.
Hong SH, Kim J, Kim JM, Lee SY, Shin DS, Son KH, Han DC, Sung YK, Kwon BM
Biochemical pharmacology 2007 Aug 15;74(4):557-65
Biochemical pharmacology 2007 Aug 15;74(4):557-65
No comments: Submit comment
No validations: Submit validation data