Explore
Validate
Learn
Western blot
Flow cytometryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN137665 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Heme Oxygenase (Decycling) 1 (HMOX1) antibody
- Antibody type
- Monoclonal
- Antigen
- Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1.
- Description
- Protein G affinity purified
- Reactivity
- Human
- Host
- Mouse
- Isotype
- IgG
- Vial size
- 50 μg
- Concentration
- Batch dependent within range: 0.80-1.00 mg/ml
- Storage
- -20°C
Submitted references Heme oxygenase: recent advances in understanding its regulation and role.
Peroxynitrite induces haem oxygenase-1 in vascular endothelial cells: a link to apoptosis.
Human heme oxygenase cDNA and induction of its mRNA by hemin.
Elbirt KK, Bonkovsky HL
Proceedings of the Association of American Physicians 1999 Sep-Oct;111(5):438-47
Proceedings of the Association of American Physicians 1999 Sep-Oct;111(5):438-47
Peroxynitrite induces haem oxygenase-1 in vascular endothelial cells: a link to apoptosis.
Foresti R, Sarathchandra P, Clark JE, Green CJ, Motterlini R
The Biochemical journal 1999 May 1;339 ( Pt 3):729-36
The Biochemical journal 1999 May 1;339 ( Pt 3):729-36
Human heme oxygenase cDNA and induction of its mRNA by hemin.
Yoshida T, Biro P, Cohen T, Müller RM, Shibahara S
European journal of biochemistry / FEBS 1988 Feb 1;171(3):457-61
European journal of biochemistry / FEBS 1988 Feb 1;171(3):457-61
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry
