HPA015984

TMEM132C antibody from Sigma-Aldrich
DKFZp761O2018, PPP1R152
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015984
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015984, RRID:AB_1858088
Product name
Anti-TMEM132C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015984
Antibody type
Polyclonal
Antigen
Transmembrane protein 132C precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNVRVKFGQNDADSSPGRDYEEDEIKNHASDRRQK
GQHHERTGQDGHLYGSSPVEREEGALRRATTTARS
LLDNKVVKNSRADGGRLAGEGQLQNIPIDFTNFPA
HVDLPKAGSGLEENDLVQ
Storage
-20C
Provider Type Product Number
- No reagents -