HPA035054

PRSS12 antibody from MilliporeSigma / Merck KGaA
BSSP-3, MRT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035054
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035054, RRID:AB_10603990
Product name
Anti-PRSS12 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035054
Antibody type
Polyclonal
Antigen
protease, serine, 12 (neurotrypsin, motopsin) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGG
KGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCE
KDIWQGGVCPQKMAAAVTCSFS
Storage
-20C
Provider Type Product Number
- No reagents -