H00000487-M06A

ATP2A1 antibody from Abnova Corporation
ATP2A, SERCA1
No application information provided.

Antibody data

Product number
H00000487-M06A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000487-M06A, RRID:AB_1203982
Product name
ATP2A1 monoclonal antibody (M06A), clone 3H4
Provider product page
Abnova Corporation - H00000487-M06A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ATP2A1.
Antigen sequence
IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGR
DTLRCLALATRDTPPKREEMVLDDSARFLEYETDL
TFVGVVGMLDPPRKEVTGSIQ
Isotype
IgG
Antibody clone number
3H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -