HPA017723

SPEM1 antibody from Sigma-Aldrich
C17orf83, FLJ40081
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017723
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017723, RRID:AB_2195560
Product name
Anti-SPEM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017723
Antibody type
Polyclonal
Antigen
Spermatid maturation protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YVYPVNPPPPSPEAPSHKNGGEGAVPEAEAAQYQP
VPAPTLGPAVIPEFSRHRSSGRIVYDARDMRRRLR
ELTREVEALSGCYPLASGSSTAEETSKNWVYRSLT
Storage
-20C
Provider Type Product Number
- No reagents -