PAB20711

FDCSP antibody from Abnova Corporation
C4orf7, FDC-SP

Antibody data

Product number
PAB20711
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20711, RRID:AB_10965238
Product name
FDCSP polyclonal antibody
Provider product page
Abnova Corporation - PAB20711
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FDCSP.
Antigen sequence
KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFP
WFRRNFPIPIPESAPTTPL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -