HPA014326

FDCSP antibody from Sigma-Aldrich
C4orf7, FDC-SP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014326
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014326, RRID:AB_1845719
Product name
Anti-C4orf7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014326
Antibody type
Polyclonal
Antigen
Follicular dendritic cell secreted peptide precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFP
WFRRNFPIPIPESAPTTPL
Storage
-20C
Provider Type Product Number
- No reagents -