HPA014326

FDCSP antibody from Atlas Antibodies
C4orf7, FDC-SP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014326
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014326, RRID:AB_1233631
Product name
Anti-FDCSP
Provider product page
Atlas Antibodies - HPA014326
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFP
WFRRNFPIPIPESAPTTPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -