HPA014326

FDCSP antibody from Atlas Antibodies
C4orf7, FDC-SP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014326
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014326, RRID:AB_1845719
Product name
Anti-FDCSP
Provider product page
Atlas Antibodies - HPA014326
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFP
WFRRNFPIPIPESAPTTPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -