HPA017584

CHST15 antibody from Sigma-Aldrich
BRAG, GALNAC4S-6ST, KIAA0598
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017584
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017584, RRID:AB_1849437
Product name
Anti-RP11-47G11.1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017584
Antibody type
Polyclonal
Antigen
N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQA
SSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNS
TDGEPPFLTQDFIHAFQPNARLIVMLRDPVER
Storage
-20C
Provider Type Product Number
- No reagents -